PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676754416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 318aa    MW: 35695 Da    PI: 8.4147
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676754416genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.61.2e-3284139359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  +++YkeClkNhAas+Gg+a+DGCgEfmps ge+g+++al+C+AC+CHRnFHRre e 
    676754416  84 TIKYKECLKNHAASMGGNAIDGCGEFMPS-GEDGSIEALTCSACNCHRNFHRREIEG 139
                  689*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2685147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-2985137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.7E-3286137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.82287136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.83E-19215285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-30221288IPR009057Homeodomain-like
TIGRFAMsTIGR015655.4E-26226282IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEVASQADHD MPIPMNTTYG NSYGAHGHVI HHHHHPANST APNPLIVPSN GNGLDKNHDH  60
PPPHRHHVGY NIMLSNNKNE KPVTIKYKEC LKNHAASMGG NAIDGCGEFM PSGEDGSIEA  120
LTCSACNCHR NFHRREIEGE EKTFFSPYHH NQPPQPQRKL MFHHHHHKMV RSPLPQQMVM  180
PIGVATAAGS NSESEDHMEE DGGGNLTFRQ PPPPPAPYSY GGHNQKKRFR TKFTQAQKEK  240
MLSFAERIGW KMQRQEESVV QQFCQEIGVR RRVLKVWMHN NKHILSKKSS NVNNDVELSA  300
GNNDTNNKAP LGDLVSSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-232272831874ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395776.11e-174hypothetical protein EUTSA_v10004643mg
SwissprotO647221e-150ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLV4KST61e-174V4KST6_EUTSA; Uncharacterized protein
STRINGAT2G02540.11e-148(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33392665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-152homeobox protein 21